![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily) multihelical; 3 layers or orthogonally packed helices |
![]() | Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) ![]() |
![]() | Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 proteins) |
![]() | Protein automated matches [190059] (14 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [187214] (171 PDB entries) |
![]() | Domain d2vstb_: 2vst B: [153532] automated match to d1wm0x_ protein/DNA complex; complexed with 243 |
PDB Entry: 2vst (more details), 2.35 Å
SCOPe Domain Sequences for d2vstb_:
Sequence, based on SEQRES records: (download)
>d2vstb_ a.123.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]} esadlralakhlydsyiksfpltkakarailtgkttdkspfviydmnslmmgedkikfkh itplqeqskevairifqgcqfrsveavqeiteyaksipgfvnldlndqvtllkygvheii ytmlaslmnkdgvlisegqgfmtreflkslrkpfgdfmepkfefavkfnalelddsdlai fiaviilsgdrpgllnvkpiediqdnllqalelqlklnhpessqlfakllqkmtdlrqiv tehvqllqvikktetdmslhpllqeiyk
>d2vstb_ a.123.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]} esadlralakhlydsyiksfpltkakarailtgkspfviydmnslmmgedkhitkevair ifqgcqfrsveavqeiteyaksipgfvnldlndqvtllkygvheiiytmlaslmnkdgvl isegqgfmtreflkslrkpfgdfmepkfefavkfnalelddsdlaifiaviilsgdrpgl lnvkpiediqdnllqalelqlklnhpessqlfakllqkmtdlrqivtehvqllqvikkth pllqeiyk
Timeline for d2vstb_: