Lineage for d2vsta_ (2vst A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2008476Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 2008477Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) (S)
  5. 2008478Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 protein domains)
  6. 2009403Protein automated matches [190059] (14 species)
    not a true protein
  7. 2009425Species Human (Homo sapiens) [TaxId:9606] [187214] (173 PDB entries)
  8. 2009560Domain d2vsta_: 2vst A: [153531]
    automated match to d1wm0x_
    protein/DNA complex; complexed with 243

Details for d2vsta_

PDB Entry: 2vst (more details), 2.35 Å

PDB Description: hPPARgamma Ligand binding domain in complex with 13-(S)-HODE
PDB Compounds: (A:) Peroxisome proliferator-activated receptor gamma

SCOPe Domain Sequences for d2vsta_:

Sequence, based on SEQRES records: (download)

>d2vsta_ a.123.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lnpesadlralakhlydsyiksfpltkakarailtgkttdkspfviydmnslmmgedkik
fkhitplqeqskevairifqgcqfrsveavqeiteyaksipgfvnldlndqvtllkygvh
eiiytmlaslmnkdgvlisegqgfmtreflkslrkpfgdfmepkfefavkfnalelddsd
laifiaviilsgdrpgllnvkpiediqdnllqalelqlklnhpessqlfakllqkmtdlr
qivtehvqllqvikktetdmslhpllqeiykd

Sequence, based on observed residues (ATOM records): (download)

>d2vsta_ a.123.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lnpesadlralakhlydsyiksfpltkakarailtgkttdkspfviydmnslmmgedkik
evairifqgcqfrsveavqeiteyaksipgfvnldlndqvtllkygvheiiytmlaslmn
kdgvlisegqgfmtreflkslrkpfgdfmepkfefavkfnalelddsdlaifiaviilsg
drpgllnvkpiediqdnllqalelqlklnhpessqlfakllqkmtdlrqivtehvqllqv
ikktetdmslhpllqeiykd

SCOPe Domain Coordinates for d2vsta_:

Click to download the PDB-style file with coordinates for d2vsta_.
(The format of our PDB-style files is described here.)

Timeline for d2vsta_: