Lineage for d2vrya1 (2vry A:3-149)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 758333Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 758334Superfamily a.1.1: Globin-like [46458] (4 families) (S)
  5. 758373Family a.1.1.2: Globins [46463] (26 proteins)
    Heme-binding protein
  6. 759858Protein Neuroglobin [100978] (2 species)
  7. 759864Species Mouse (Mus musculus) [TaxId:10090] [109625] (3 PDB entries)
    Uniprot Q9ER97
  8. 759866Domain d2vrya1: 2vry A:3-149 [153525]
    automatically matched to d1q1fa_
    complexed with hem, so4; mutant

Details for d2vrya1

PDB Entry: 2vry (more details), 1.87 Å

PDB Description: mouse neuroglobin with heme iron in the reduced ferrous state
PDB Compounds: (A:) neuroglobin

SCOP Domain Sequences for d2vrya1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vrya1 a.1.1.2 (A:3-149) Neuroglobin {Mouse (Mus musculus) [TaxId: 10090]}
rpeselirqswrvvsrsplehgtvlfarlfalepsllplfqyngrqfsspedslsspefl
dhirkvmlvidaavtnvedlssleeyltslgrkhravgvrlssfstvgesllymlekslg
pdftpatrtawsrlygavvqamsrgwd

SCOP Domain Coordinates for d2vrya1:

Click to download the PDB-style file with coordinates for d2vrya1.
(The format of our PDB-style files is described here.)

Timeline for d2vrya1: