SCOP 1.75: Domain d2vrya1: 2vry A:3-149

Lineage for d2vrya1 (2vry A:3-149)

1. Root: SCOP 1.75

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (4 families)

5. Family a.1.1.2: Globins [46463] (26 proteins)
   Heme-binding protein

6. Protein Neuroglobin [100978] (2 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [109625] (3 PDB entries)
   Uniprot Q9ER97

8. Domain d2vrya1: 2vry A:3-149 [153525]
   automatically matched to d1q1fa_
   complexed with hem, so4; mutant

Details for d2vrya1

PDB Entry: 2vry, 1.87 Å

PDB Description: mouse neuroglobin with heme iron in the reduced ferrous state

PDB Compounds: (A:) neuroglobin

SCOP Domain Sequences for d2vrya1:

Sequence; same for both SEQRES and ATOM records:

>d2vrya1 a.1.1.2 (A:3-149) Neuroglobin {Mouse (Mus musculus) [TaxId: 10090]}
rpeselirqswrvvsrsplehgtvlfarlfalepsllplfqyngrqfsspedslsspefl
dhirkvmlvidaavtnvedlssleeyltslgrkhravgvrlssfstvgesllymlekslg
pdftpatrtawsrlygavvqamsrgwd

Timeline for d2vrya1:

• d2vrya1 is new in SCOP 1.75
  
• d2vrya1 is called d2vrya_ in SCOPe 2.01
  
• d2vrya1 appears in the current release, SCOPe 2.08, called d2vrya_