Lineage for d2vrya_ (2vry A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2685878Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 2685879Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 2685963Family a.1.1.2: Globins [46463] (27 proteins)
    Heme-binding protein
  6. 2688401Protein automated matches [190359] (43 species)
    not a true protein
  7. 2688741Species Mouse (Mus musculus) [TaxId:10090] [187190] (2 PDB entries)
  8. 2688742Domain d2vrya_: 2vry A: [153525]
    automated match to d1q1fa_
    complexed with hem, so4

Details for d2vrya_

PDB Entry: 2vry (more details), 1.87 Å

PDB Description: mouse neuroglobin with heme iron in the reduced ferrous state
PDB Compounds: (A:) neuroglobin

SCOPe Domain Sequences for d2vrya_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vrya_ a.1.1.2 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
rpeselirqswrvvsrsplehgtvlfarlfalepsllplfqyngrqfsspedslsspefl
dhirkvmlvidaavtnvedlssleeyltslgrkhravgvrlssfstvgesllymlekslg
pdftpatrtawsrlygavvqamsrgwd

SCOPe Domain Coordinates for d2vrya_:

Click to download the PDB-style file with coordinates for d2vrya_.
(The format of our PDB-style files is described here.)

Timeline for d2vrya_: