Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
Superfamily d.15.1: Ubiquitin-like [54236] (9 families) |
Family d.15.1.0: automated matches [191343] (1 protein) not a true family |
Protein automated matches [190233] (6 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187090] (15 PDB entries) |
Domain d2vrrb_: 2vrr B: [153523] Other proteins in same PDB: d2vrra_ automated match to d2ckhb1 complexed with fmt, na |
PDB Entry: 2vrr (more details), 2.22 Å
SCOPe Domain Sequences for d2vrrb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2vrrb_ d.15.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]} meyiklkvigqdsseihfkvkmtthlkklkesycqrqgvpmnslrflfegqriadnhtpk elgmeeedvievyqeqtgg
Timeline for d2vrrb_: