SCOPe 2.08: Domain d2vrrb2: 2vrr B:20-97

Lineage for d2vrrb2 (2vrr B:20-97)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.1: Ubiquitin-like [54236] (11 families)

5. Family d.15.1.0: automated matches [191343] (1 protein)
   not a true family

6. Protein automated matches [190233] (31 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187090] (156 PDB entries)

8. Domain d2vrrb2: 2vrr B:20-97 [153523]
   Other proteins in same PDB: d2vrra_, d2vrrb3
   automated match to d2ckhb1
   complexed with fmt, na

Details for d2vrrb2

PDB Entry: 2vrr, 2.22 Å

PDB Description: structure of sumo modified ubc9

PDB Compounds: (B:) Small ubiquitin-related modifier 1

SCOPe Domain Sequences for d2vrrb2:

Sequence; same for both SEQRES and ATOM records:

>d2vrrb2 d.15.1.0 (B:20-97) automated matches {Human (Homo sapiens) [TaxId: 9606]}
eyiklkvigqdsseihfkvkmtthlkklkesycqrqgvpmnslrflfegqriadnhtpke
lgmeeedvievyqeqtgg

Timeline for d2vrrb2:

• d2vrrb2 first appeared in SCOP 1.75, called d2vrrb1
  
• d2vrrb2 was called d2vrrb_ in SCOPe 2.07