SCOP 1.75: Domain d2vrlb2: 2vrl B:290-401

Lineage for d2vrlb2 (2vrl B:290-401)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.16: FAD-linked reductases, C-terminal domain [54372] (1 superfamily)
   alpha+beta sandwich

4. Superfamily d.16.1: FAD-linked reductases, C-terminal domain [54373] (7 families)
   N-terminal domain is beta/beta/alpha common fold

5. Family d.16.1.5: L-aminoacid/polyamine oxidase [54394] (6 proteins)

6. Protein Monoamine oxidase B [69673] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [69674] (15 PDB entries)

8. Domain d2vrlb2: 2vrl B:290-401 [153517]
   Other proteins in same PDB: d2vrla1, d2vrlb1
   automatically matched to d1o5wa2
   complexed with fad, mbn

Details for d2vrlb2

PDB Entry: 2vrl, 2.4 Å

PDB Description: structure of human mao b in complex with benzylhydrazine

PDB Compounds: (B:) amine oxidase [flavin-containing] b

SCOP Domain Sequences for d2vrlb2:

Sequence; same for both SEQRES and ATOM records:

>d2vrlb2 d.16.1.5 (B:290-401) Monoamine oxidase B {Human (Homo sapiens) [TaxId: 9606]}
plgsvikcivyykepfwrkkdycgtmiidgeeapvaytlddtkpegnyaaimgfilahka
rklarltkeerlkklcelyakvlgslealepvhyeeknwceeqysggcytty

Timeline for d2vrlb2:

• d2vrlb2 is new in SCOP 1.75
  
• d2vrlb2 appears in SCOPe 2.01
  
• d2vrlb2 appears in the current release, SCOPe 2.08