Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily) core: 3 layers, b/b/a; central parallel beta-sheet of 5 strands, order 32145; top antiparallel beta-sheet of 3 strands, meander |
Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (8 families) |
Family c.3.1.2: FAD-linked reductases, N-terminal domain [51913] (18 proteins) C-terminal domain is alpha+beta is common for the family |
Protein Monoamine oxidase B [69423] (2 species) |
Species Human (Homo sapiens) [TaxId:9606] [69424] (15 PDB entries) |
Domain d2vrlb1: 2vrl B:6-289,B:402-496 [153516] Other proteins in same PDB: d2vrla2, d2vrlb2 automatically matched to d1o5wc1 complexed with fad, mbn |
PDB Entry: 2vrl (more details), 2.4 Å
SCOPe Domain Sequences for d2vrlb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2vrlb1 c.3.1.2 (B:6-289,B:402-496) Monoamine oxidase B {Human (Homo sapiens) [TaxId: 9606]} dvvvvgggisgmaaakllhdsglnvvvleardrvggrtytlrnqkvkyvdlggsyvgptq nrilrlakelgletykvneverlihhvkgksypfrgpfppvwnpityldhnnfwrtmddm greipsdapwkaplaeewdnmtmkelldklcwtesakqlatlfvnlcvtaethevsalwf lwyvkqcggttriisttnggqerkfvggsgqvserimdllgdrvklerpviyidqtrenv lvetlnhemyeakyvisaipptlgmkihfnpplpmmrnqmitrvXfppgiltqygrvlrq pvdriyfagtetathwsgymegaveageraareilhamgkipedeiwqsepesvdvpaqp itttflerhlpsvpgllrli
Timeline for d2vrlb1: