![]() | Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
![]() | Fold d.12: Ribosomal proteins S24e, L23 and L15e [54188] (1 superfamily) beta-(alpha)-beta-alpha-beta(2); 3 layers: alpha/beta/alpha; antiparallel beta-sheet: order 1243 |
![]() | Superfamily d.12.1: Ribosomal proteins S24e, L23 and L15e [54189] (3 families) ![]() |
![]() | Family d.12.1.1: L23p [54190] (1 protein) |
![]() | Protein Ribosomal protein L23 [54191] (4 species) |
![]() | Species Escherichia coli [TaxId:562] [159878] (28 PDB entries) Uniprot P02424 1-99 |
![]() | Domain d2vrhb1: 2vrh B:1-99 [153509] Other proteins in same PDB: d2vrha1, d2vrha2, d2vrha3, d2vrhc1, d2vrhd1 automatically matched to 2AW4 T:1-99 |
PDB Entry: 2vrh (more details), 19 Å
SCOP Domain Sequences for d2vrhb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2vrhb1 d.12.1.1 (B:1-99) Ribosomal protein L23 {Escherichia coli [TaxId: 562]} mireerllkvlraphvsekastameksntivlkvakdatkaeikaavqklfevevevvnt lvvkgkvkrhgqrigrrsdwkkayvtlkegqnldfvgga
Timeline for d2vrhb1: