Lineage for d2vrha3 (2vrh A:132-247)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2185704Fold d.26: FKBP-like [54533] (3 superfamilies)
    core: beta(2)-alpha-beta(2); antiparallel beta-sheet
  4. 2185705Superfamily d.26.1: FKBP-like [54534] (4 families) (S)
  5. 2185706Family d.26.1.1: FKBP immunophilin/proline isomerase [54535] (17 proteins)
  6. 2185930Protein Trigger factor PPIase domain [75388] (3 species)
  7. 2185931Species Escherichia coli [TaxId:562] [89881] (3 PDB entries)
    Uniprot P22257
  8. 2185935Domain d2vrha3: 2vrh A:132-247 [153508]
    Other proteins in same PDB: d2vrha1, d2vrha2, d2vrhb1, d2vrhc1, d2vrhd1
    automatically matched to d1w26a3
    protein/RNA complex

Details for d2vrha3

PDB Entry: 2vrh (more details), 19 Å

PDB Description: structure of the e. coli trigger factor bound to a translating ribosome
PDB Compounds: (A:) Trigger Factor

SCOPe Domain Sequences for d2vrha3:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vrha3 d.26.1.1 (A:132-247) Trigger factor PPIase domain {Escherichia coli [TaxId: 562]}
vtdadvdgmldtlrkqqatwkekdgaveaedrvtidftgsvdgeefeggkasdfvlamgq
grmipgfedgikghkageeftidvtfpeeyhaenlkgkaakfainlkkveerelpe

SCOPe Domain Coordinates for d2vrha3:

Click to download the PDB-style file with coordinates for d2vrha3.
(The format of our PDB-style files is described here.)

Timeline for d2vrha3: