Lineage for d2vrha2 (2vrh A:1-131)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 881334Fold d.241: Ribosome binding domain-like [100965] (2 superfamilies)
    beta-(2)-alpha(2)-beta(2); 2 layers: beta/alpha; antiparallel beta-sheet: order 1243; topological similarity to the common core of ribosomal proteins L23 and L15e
  4. 881342Superfamily d.241.2: Trigger factor ribosome-binding domain [102735] (1 family) (S)
  5. 881343Family d.241.2.1: Trigger factor ribosome-binding domain [102736] (1 protein)
  6. 881344Protein Trigger factor ribosome-binding domain [102737] (2 species)
  7. 881345Species Escherichia coli [TaxId:562] [102738] (4 PDB entries)
    Uniprot P22257
  8. 881353Domain d2vrha2: 2vrh A:1-131 [153507]
    Other proteins in same PDB: d2vrha1, d2vrha3, d2vrhb1, d2vrhc1, d2vrhd1
    automatically matched to d1w26a2

Details for d2vrha2

PDB Entry: 2vrh (more details), 19 Å

PDB Description: structure of the e. coli trigger factor bound to a translating ribosome
PDB Compounds: (A:) Trigger Factor

SCOP Domain Sequences for d2vrha2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vrha2 d.241.2.1 (A:1-131) Trigger factor ribosome-binding domain {Escherichia coli [TaxId: 562]}
mqvsvettqglgrrvtitiaadsietavkselvnvakkvridgfrkgkvpmnivaqryga
svrqdvlgdlmsrnfidaiikekinpagaptyvpgeyklgedftysvefevypevelqgl
eaievekpive

SCOP Domain Coordinates for d2vrha2:

Click to download the PDB-style file with coordinates for d2vrha2.
(The format of our PDB-style files is described here.)

Timeline for d2vrha2: