Lineage for d2vr4b4 (2vr4 B:27-219)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2383785Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll
  4. 2383786Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) (S)
  5. 2384653Family b.18.1.0: automated matches [191481] (1 protein)
    not a true family
  6. 2384654Protein automated matches [190770] (49 species)
    not a true protein
  7. 2384714Species Bacteroides thetaiotaomicron [TaxId:226186] [255611] (7 PDB entries)
  8. 2384718Domain d2vr4b4: 2vr4 B:27-219 [153503]
    Other proteins in same PDB: d2vr4a1, d2vr4a2, d2vr4a3, d2vr4a5, d2vr4b1, d2vr4b2, d2vr4b3, d2vr4b5, d2vr4b6
    automated match to d2je8a4
    complexed with 17b, br, cl, edo

Details for d2vr4b4

PDB Entry: 2vr4 (more details), 1.8 Å

PDB Description: transition-state mimicry in mannoside hydrolysis: characterisation of twenty six inhibitors and insight into binding from linear free energy relationships and 3-d structure
PDB Compounds: (B:) beta-mannosidase

SCOPe Domain Sequences for d2vr4b4:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vr4b4 b.18.1.0 (B:27-219) automated matches {Bacteroides thetaiotaomicron [TaxId: 226186]}
gndtsevmlldtgwefsqsgtekwmpatvpgtvhqdlishellpnpfygmnekkiqwven
edweyrtsfivseeqlnrdgiqlifegldtyadvylngslllkadnmfvgytlpvksvlr
kgenhlyiyfhspirqtlpqyasngfnypadndhhekhlsvfsrkapysygwdwgirmvt
sgvwrpvtlrfyd

SCOPe Domain Coordinates for d2vr4b4:

Click to download the PDB-style file with coordinates for d2vr4b4.
(The format of our PDB-style files is described here.)

Timeline for d2vr4b4: