| Class b: All beta proteins [48724] (174 folds) |
| Fold b.18: Galactose-binding domain-like [49784] (1 superfamily) sandwich; 9 strands in 2 sheets; jelly-roll |
Superfamily b.18.1: Galactose-binding domain-like [49785] (32 families) ![]() |
| Family b.18.1.5: beta-Galactosidase/glucuronidase, N-terminal domain [49803] (4 proteins) |
| Protein Beta-mannosidase [158959] (1 species) |
| Species Bacteroides thetaiotaomicron [TaxId:818] [158960] (9 PDB entries) Uniprot Q8AAK6 28-219 |
| Domain d2vr4b4: 2vr4 B:28-219 [153503] Other proteins in same PDB: d2vr4a1, d2vr4a2, d2vr4a3, d2vr4a5, d2vr4b1, d2vr4b2, d2vr4b3, d2vr4b5 automatically matched to 2JE8 A:28-219 complexed with 17b, br, cl, edo |
PDB Entry: 2vr4 (more details), 1.8 Å
SCOP Domain Sequences for d2vr4b4:
Sequence; same for both SEQRES and ATOM records: (download)
>d2vr4b4 b.18.1.5 (B:28-219) Beta-mannosidase {Bacteroides thetaiotaomicron [TaxId: 818]}
ndtsevmlldtgwefsqsgtekwmpatvpgtvhqdlishellpnpfygmnekkiqwvene
dweyrtsfivseeqlnrdgiqlifegldtyadvylngslllkadnmfvgytlpvksvlrk
genhlyiyfhspirqtlpqyasngfnypadndhhekhlsvfsrkapysygwdwgirmvts
gvwrpvtlrfyd
Timeline for d2vr4b4: