Lineage for d2vr4a4 (2vr4 A:28-219)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2774100Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll
  4. 2774101Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) (S)
  5. 2774971Family b.18.1.0: automated matches [191481] (1 protein)
    not a true family
  6. 2774972Protein automated matches [190770] (51 species)
    not a true protein
  7. 2775032Species Bacteroides thetaiotaomicron [TaxId:226186] [255611] (7 PDB entries)
  8. 2775035Domain d2vr4a4: 2vr4 A:28-219 [153498]
    Other proteins in same PDB: d2vr4a1, d2vr4a2, d2vr4a3, d2vr4a5, d2vr4b1, d2vr4b2, d2vr4b3, d2vr4b5, d2vr4b6
    automated match to d2je8a4
    complexed with 17b, br, cl, edo

Details for d2vr4a4

PDB Entry: 2vr4 (more details), 1.8 Å

PDB Description: transition-state mimicry in mannoside hydrolysis: characterisation of twenty six inhibitors and insight into binding from linear free energy relationships and 3-d structure
PDB Compounds: (A:) beta-mannosidase

SCOPe Domain Sequences for d2vr4a4:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vr4a4 b.18.1.0 (A:28-219) automated matches {Bacteroides thetaiotaomicron [TaxId: 226186]}
ndtsevmlldtgwefsqsgtekwmpatvpgtvhqdlishellpnpfygmnekkiqwvene
dweyrtsfivseeqlnrdgiqlifegldtyadvylngslllkadnmfvgytlpvksvlrk
genhlyiyfhspirqtlpqyasngfnypadndhhekhlsvfsrkapysygwdwgirmvts
gvwrpvtlrfyd

SCOPe Domain Coordinates for d2vr4a4:

Click to download the PDB-style file with coordinates for d2vr4a4.
(The format of our PDB-style files is described here.)

Timeline for d2vr4a4: