![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.18: Galactose-binding domain-like [49784] (1 superfamily) sandwich; 9 strands in 2 sheets; jelly-roll |
![]() | Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) ![]() |
![]() | Family b.18.1.0: automated matches [191481] (1 protein) not a true family |
![]() | Protein automated matches [190770] (51 species) not a true protein |
![]() | Species Bacteroides thetaiotaomicron [TaxId:226186] [255611] (7 PDB entries) |
![]() | Domain d2vr4a4: 2vr4 A:28-219 [153498] Other proteins in same PDB: d2vr4a1, d2vr4a2, d2vr4a3, d2vr4a5, d2vr4b1, d2vr4b2, d2vr4b3, d2vr4b5, d2vr4b6 automated match to d2je8a4 complexed with 17b, br, cl, edo |
PDB Entry: 2vr4 (more details), 1.8 Å
SCOPe Domain Sequences for d2vr4a4:
Sequence; same for both SEQRES and ATOM records: (download)
>d2vr4a4 b.18.1.0 (A:28-219) automated matches {Bacteroides thetaiotaomicron [TaxId: 226186]} ndtsevmlldtgwefsqsgtekwmpatvpgtvhqdlishellpnpfygmnekkiqwvene dweyrtsfivseeqlnrdgiqlifegldtyadvylngslllkadnmfvgytlpvksvlrk genhlyiyfhspirqtlpqyasngfnypadndhhekhlsvfsrkapysygwdwgirmvts gvwrpvtlrfyd
Timeline for d2vr4a4: