SCOPe 2.06: Domain d2vr1b2: 2vr1 B:1-114

Lineage for d2vr1b2 (2vr1 B:1-114)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.30: PreATP-grasp domain [52439] (1 superfamily)
   3 layers: a/b/a; parallel or mixed beta-sheet of 4 to 6 strands
   possible rudiment form of Rossmann-fold domain

4. Superfamily c.30.1: PreATP-grasp domain [52440] (10 families)
   precedes the ATP-grasp domain common to all superfamily members, can contain a substrate-binding function

5. Family c.30.1.1: BC N-terminal domain-like [52441] (6 proteins)

6. Protein Biotin carboxylase (BC), N-terminal domain [52442] (2 species)
   subunit of acetyl-CoA and pyruvate carboxylases

7. Species Escherichia coli [TaxId:562] [52443] (24 PDB entries)

8. Domain d2vr1b2: 2vr1 B:1-114 [153493]
   Other proteins in same PDB: d2vr1a1, d2vr1a3, d2vr1b1, d2vr1b3
   automated match to d1dv1a2
   complexed with atf, cl

Details for d2vr1b2

PDB Entry: 2vr1, 2.6 Å

PDB Description: crystal structure of biotin carboxylase from e. coli in complex with atp analog, adpcf2p.

PDB Compounds: (B:) biotin carboxylase

SCOPe Domain Sequences for d2vr1b2:

Sequence; same for both SEQRES and ATOM records:

>d2vr1b2 c.30.1.1 (B:1-114) Biotin carboxylase (BC), N-terminal domain {Escherichia coli [TaxId: 562]}
mldkivianrgeialrilrackelgiktvavhssadrdlkhvlladetvcigpapsvksy
lnipaiisaaeitgavaihpgygflsenanfaeqversgfifigpkaetirlmg

Timeline for d2vr1b2:

• d2vr1b2 first appeared in SCOP 1.75
  
• d2vr1b2 appears in SCOPe 2.05
  
• d2vr1b2 appears in SCOPe 2.07
  
• d2vr1b2 appears in the current release, SCOPe 2.08