SCOPe 2.05: Domain d2vr1b1: 2vr1 B:331-446

Lineage for d2vr1b1 (2vr1 B:331-446)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.84: Barrel-sandwich hybrid [51229] (4 superfamilies)
   sandwich of half-barrel shaped beta-sheets

4. Superfamily b.84.2: Rudiment single hybrid motif [51246] (3 families)

5. Family b.84.2.1: BC C-terminal domain-like [51247] (5 proteins)
   probable rudiment form of the biotinyl-carrier domain

6. Protein Biotin carboxylase (BC), C-domain [51248] (2 species)
   subunit of acetyl-CoA and pyruvate carboxylases

7. Species Escherichia coli [TaxId:562] [51249] (24 PDB entries)

8. Domain d2vr1b1: 2vr1 B:331-446 [153492]
   Other proteins in same PDB: d2vr1a2, d2vr1a3, d2vr1b2, d2vr1b3
   automated match to d1dv1a1
   complexed with atf, cl

Details for d2vr1b1

PDB Entry: 2vr1, 2.6 Å

PDB Description: crystal structure of biotin carboxylase from e. coli in complex with atp analog, adpcf2p.

PDB Compounds: (B:) biotin carboxylase

SCOPe Domain Sequences for d2vr1b1:

Sequence; same for both SEQRES and ATOM records:

>d2vr1b1 b.84.2.1 (B:331-446) Biotin carboxylase (BC), C-domain {Escherichia coli [TaxId: 562]}
rghavecrinaedpntflpspgkitrfhapggfgvrweshiyagytvppyydsmigklic
ygenrdvaiarmknalqeliidgiktnvdlqirimndenfqhggtnihylekklgl

Timeline for d2vr1b1:

• d2vr1b1 first appeared in SCOP 1.75
  
• d2vr1b1 appears in SCOPe 2.04
  
• d2vr1b1 appears in SCOPe 2.06
  
• d2vr1b1 appears in the current release, SCOPe 2.08