Lineage for d1abya1 (1aby A:1-142)

  1. Root: SCOP 1.65
  2. 275720Class a: All alpha proteins [46456] (179 folds)
  3. 275721Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 275722Superfamily a.1.1: Globin-like [46458] (4 families) (S)
  5. 275747Family a.1.1.2: Globins [46463] (18 proteins)
    Heme-binding protein
  6. 275852Protein Hemoglobin, alpha-chain [46486] (16 species)
  7. 275901Species Human (Homo sapiens) [TaxId:9606] [46487] (100 PDB entries)
  8. 276059Domain d1abya1: 1aby A:1-142 [15349]
    Other proteins in same PDB: d1abyb_, d1abyd_

Details for d1abya1

PDB Entry: 1aby (more details), 2.6 Å

PDB Description: cyanomet rhb1.1 (recombinant hemoglobin)
PDB Compounds: (A:)

SCOP Domain Sequences for d1abya1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1abya1 a.1.1.2 (A:1-142) Hemoglobin, alpha-chain {Human (Homo sapiens)}
mlspadktnvkaawgkvgahageygaealermflsfpttktyfphfdlshgsaqvkghgk
kvadaltnavahvddmpnalsalsdlhahklrvdpvnfkllshcllvtlaahlpaeftpa
vhasldkflasvstvltskyrg

SCOP Domain Coordinates for d1abya1:

Click to download the PDB-style file with coordinates for d1abya1.
(The format of our PDB-style files is described here.)

Timeline for d1abya1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1abya2