Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) |
Family c.1.8.3: beta-glycanases [51487] (27 proteins) consist of a number of sequence families |
Protein Five-domain beta-mannosidase, domain 3 [159385] (1 species) |
Species Bacteroides thetaiotaomicron [TaxId:818] [159386] (2 PDB entries) Uniprot Q8AAK6 330-678! Uniprot Q8AAK6 331-678 |
Domain d2vqub5: 2vqu B:331-678 [153488] Other proteins in same PDB: d2vqua1, d2vqua2, d2vqua3, d2vqua4, d2vqub1, d2vqub2, d2vqub3, d2vqub4, d2vqub6 automated match to d2vqua5 complexed with br, cl, edo, noy |
PDB Entry: 2vqu (more details), 1.9 Å
SCOPe Domain Sequences for d2vqub5:
Sequence; same for both SEQRES and ATOM records: (download)
>d2vqub5 c.1.8.3 (B:331-678) Five-domain beta-mannosidase, domain 3 {Bacteroides thetaiotaomicron [TaxId: 818]} rtirvvnekdkdgesfyfevngipmfakganyipqdallpnvtteryqtlfrdmkeanmn mvriwgggtyennlfydladengilvwqdfmfactpypsdptflkrveaeavynirrlrn haslamwcgnneilealkywgfekkftpevyqglmhgydklfrellpstvkefdsdrfyv hsspylanwgrpeswgtgdshnwgvwygkkpfesldtdlprfmsefgfqsfpemktiaaf aapedyqiesevmnahqkssignslirtymerdyiipesfedfvyvglvlqgqgmrhgle ahrrnrpycmgtlyaqlndswpvvswssidyygnwkalhyqakrafap
Timeline for d2vqub5: