| Class b: All beta proteins [48724] (180 folds) |
| Fold b.18: Galactose-binding domain-like [49784] (1 superfamily) sandwich; 9 strands in 2 sheets; jelly-roll |
Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) ![]() |
| Family b.18.1.5: beta-Galactosidase/glucuronidase, N-terminal domain [49803] (4 proteins) |
| Protein Beta-mannosidase [158959] (1 species) |
| Species Bacteroides thetaiotaomicron [TaxId:818] [158960] (2 PDB entries) Uniprot Q8AAK6 28-219 |
| Domain d2vqub4: 2vqu B:28-219 [153487] Other proteins in same PDB: d2vqua1, d2vqua2, d2vqua3, d2vqua5, d2vqub1, d2vqub2, d2vqub3, d2vqub5, d2vqub6 automated match to d2vqua4 complexed with br, cl, edo, noy |
PDB Entry: 2vqu (more details), 1.9 Å
SCOPe Domain Sequences for d2vqub4:
Sequence; same for both SEQRES and ATOM records: (download)
>d2vqub4 b.18.1.5 (B:28-219) Beta-mannosidase {Bacteroides thetaiotaomicron [TaxId: 818]}
ndtsevmlldtgwefsqsgtekwmpatvpgtvhqdlishellpnpfygmnekkiqwvene
dweyrtsfivseeqlnrdgiqlifegldtyadvylngslllkadnmfvgytlpvksvlrk
genhlyiyfhspirqtlpqyasngfnypadndhhekhlsvfsrkapysygwdwgirmvts
gvwrpvtlrfyd
Timeline for d2vqub4: