Lineage for d2vqub4 (2vqu B:28-219)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2774100Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll
  4. 2774101Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) (S)
  5. 2774233Family b.18.1.5: beta-Galactosidase/glucuronidase, N-terminal domain [49803] (4 proteins)
  6. 2774471Protein Beta-mannosidase [158959] (1 species)
  7. 2774472Species Bacteroides thetaiotaomicron [TaxId:818] [158960] (2 PDB entries)
    Uniprot Q8AAK6 28-219
  8. 2774476Domain d2vqub4: 2vqu B:28-219 [153487]
    Other proteins in same PDB: d2vqua1, d2vqua2, d2vqua3, d2vqua5, d2vqub1, d2vqub2, d2vqub3, d2vqub5, d2vqub6
    automated match to d2vqua4
    complexed with br, cl, edo, noy

Details for d2vqub4

PDB Entry: 2vqu (more details), 1.9 Å

PDB Description: structural and biochemical evidence for a boat-like transition state in beta-mannosidases
PDB Compounds: (B:) beta-mannosidase

SCOPe Domain Sequences for d2vqub4:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vqub4 b.18.1.5 (B:28-219) Beta-mannosidase {Bacteroides thetaiotaomicron [TaxId: 818]}
ndtsevmlldtgwefsqsgtekwmpatvpgtvhqdlishellpnpfygmnekkiqwvene
dweyrtsfivseeqlnrdgiqlifegldtyadvylngslllkadnmfvgytlpvksvlrk
genhlyiyfhspirqtlpqyasngfnypadndhhekhlsvfsrkapysygwdwgirmvts
gvwrpvtlrfyd

SCOPe Domain Coordinates for d2vqub4:

Click to download the PDB-style file with coordinates for d2vqub4.
(The format of our PDB-style files is described here.)

Timeline for d2vqub4: