Class b: All beta proteins [48724] (178 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.4: beta-Galactosidase/glucuronidase domain [49303] (2 families) |
Family b.1.4.1: beta-Galactosidase/glucuronidase domain [49304] (4 proteins) |
Protein Beta-mannosidase, domains 2, 4 and 5 [158905] (1 species) truncated domain 5 lacks the last strand |
Species Bacteroides thetaiotaomicron [TaxId:818] [158906] (2 PDB entries) Uniprot Q8AAK6 220-330! Uniprot Q8AAK6 679-783! Uniprot Q8AAK6 784-864 |
Domain d2vqub2: 2vqu B:220-330 [153485] Other proteins in same PDB: d2vqua4, d2vqua5, d2vqub4, d2vqub5, d2vqub6 automated match to d2vqua2 complexed with br, cl, edo, noy |
PDB Entry: 2vqu (more details), 1.9 Å
SCOPe Domain Sequences for d2vqub2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2vqub2 b.1.4.1 (B:220-330) Beta-mannosidase, domains 2, 4 and 5 {Bacteroides thetaiotaomicron [TaxId: 818]} iatisdyyvrqlsltdenarlsnelivnqivpqkipaevrvnvslngttvtevkqqvtlq pginhitlpaevtnpvrwmpngwgtptlydfsaqiacgdrivaeqshrigl
Timeline for d2vqub2: