Lineage for d2vqua5 (2vqu A:331-678)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 968086Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 969862Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 970330Family c.1.8.3: beta-glycanases [51487] (27 proteins)
    consist of a number of sequence families
  6. 970653Protein Five-domain beta-mannosidase, domain 3 [159385] (1 species)
  7. 970654Species Bacteroides thetaiotaomicron [TaxId:818] [159386] (9 PDB entries)
    Uniprot Q8AAK6 330-678! Uniprot Q8AAK6 331-678
  8. 970663Domain d2vqua5: 2vqu A:331-678 [153483]
    Other proteins in same PDB: d2vqua1, d2vqua2, d2vqua3, d2vqua4, d2vqub1, d2vqub2, d2vqub3, d2vqub4
    complexed with br, cl, edo, noy

Details for d2vqua5

PDB Entry: 2vqu (more details), 1.9 Å

PDB Description: structural and biochemical evidence for a boat-like transition state in beta-mannosidases
PDB Compounds: (A:) beta-mannosidase

SCOPe Domain Sequences for d2vqua5:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vqua5 c.1.8.3 (A:331-678) Five-domain beta-mannosidase, domain 3 {Bacteroides thetaiotaomicron [TaxId: 818]}
rtirvvnekdkdgesfyfevngipmfakganyipqdallpnvtteryqtlfrdmkeanmn
mvriwgggtyennlfydladengilvwqdfmfactpypsdptflkrveaeavynirrlrn
haslamwcgnneilealkywgfekkftpevyqglmhgydklfrellpstvkefdsdrfyv
hsspylanwgrpeswgtgdshnwgvwygkkpfesldtdlprfmsefgfqsfpemktiaaf
aapedyqiesevmnahqkssignslirtymerdyiipesfedfvyvglvlqgqgmrhgle
ahrrnrpycmgtlyaqlndswpvvswssidyygnwkalhyqakrafap

SCOPe Domain Coordinates for d2vqua5:

Click to download the PDB-style file with coordinates for d2vqua5.
(The format of our PDB-style files is described here.)

Timeline for d2vqua5: