SCOP 1.57: Domain d1rvwa_: 1rvw A:

Lineage for d1rvwa_ (1rvw A:)

1. Root: SCOP 1.57

2. Class a: All alpha proteins [46456] (144 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)

4. Superfamily a.1.1: Globin-like [46458] (3 families)

5. Family a.1.1.2: Globins [46463] (17 proteins)

6. Protein Hemoglobin, alpha-chain [46486] (14 species)

7. Species Human (Homo sapiens) [TaxId:9606] [46487] (73 PDB entries)

8. Domain d1rvwa_: 1rvw A: [15348]
   Other proteins in same PDB: d1rvwb_

Details for d1rvwa_

PDB Entry: 1rvw, 2.5 Å

PDB Description: r state human hemoglobin [alpha v96w], carbonmonoxy

SCOP Domain Sequences for d1rvwa_:

Sequence; same for both SEQRES and ATOM records:

>d1rvwa_ a.1.1.2 (A:) Hemoglobin, alpha-chain {Human (Homo sapiens)}
vlspadktnvkaawgkvgahageygaealermflsfpttktyfphfdlshgsaqvkghgk
kvadaltnavahvddmpnalsalsdlhahklrvdpwnfkllshcllvtlaahlpaeftpa
vhasldkflasvstvltskyr

Timeline for d1rvwa_:

• d1rvwa_ first appeared (with stable ids) in SCOP 1.55
  
• d1rvwa_ appears in SCOP 1.59
  
• d1rvwa_ appears in the current release, SCOPe 2.08