Lineage for d2vqtb5 (2vqt B:331-678)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2434695Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2438500Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2439241Family c.1.8.3: beta-glycanases [51487] (27 proteins)
    consist of a number of sequence families
  6. 2439898Protein automated matches [190057] (27 species)
    not a true protein
  7. Species Bacteroides thetaiotaomicron [TaxId:818] [255622] (1 PDB entry)
  8. 2439966Domain d2vqtb5: 2vqt B:331-678 [153478]
    Other proteins in same PDB: d2vqta1, d2vqta2, d2vqta3, d2vqta4, d2vqtb1, d2vqtb2, d2vqtb3, d2vqtb4, d2vqtb6
    automated match to d2je8a5
    complexed with 15a, br, cl, edo

Details for d2vqtb5

PDB Entry: 2vqt (more details), 2.1 Å

PDB Description: structural and biochemical evidence for a boat-like transition state in beta-mannosidases
PDB Compounds: (B:) beta-mannosidase

SCOPe Domain Sequences for d2vqtb5:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vqtb5 c.1.8.3 (B:331-678) automated matches {Bacteroides thetaiotaomicron [TaxId: 818]}
rtirvvnekdkdgesfyfevngipmfakganyipqdallpnvtteryqtlfrdmkeanmn
mvriwgggtyennlfydladengilvwqdfmfactpypsdptflkrveaeavynirrlrn
haslamwcgnneilealkywgfekkftpevyqglmhgydklfrellpstvkefdsdrfyv
hsspylanwgrpeswgtgdshnwgvwygkkpfesldtdlprfmsefgfqsfpemktiaaf
aapedyqiesevmnahqkssignslirtymerdyiipesfedfvyvglvlqgqgmrhgle
ahrrnrpycmgtlywqlndswpvvswssidyygnwkalhyqakrafap

SCOPe Domain Coordinates for d2vqtb5:

Click to download the PDB-style file with coordinates for d2vqtb5.
(The format of our PDB-style files is described here.)

Timeline for d2vqtb5: