| Class b: All beta proteins [48724] (180 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.4: beta-Galactosidase/glucuronidase domain [49303] (2 families) ![]() |
| Family b.1.4.0: automated matches [254272] (1 protein) not a true family |
| Protein automated matches [254633] (19 species) not a true protein |
| Species Bacteroides thetaiotaomicron [TaxId:818] [255621] (1 PDB entry) |
| Domain d2vqtb3: 2vqt B:679-783 [153476] Other proteins in same PDB: d2vqta4, d2vqta5, d2vqtb4, d2vqtb5, d2vqtb6 automated match to d2je8a3 complexed with 15a, br, cl, edo |
PDB Entry: 2vqt (more details), 2.1 Å
SCOPe Domain Sequences for d2vqtb3:
Sequence; same for both SEQRES and ATOM records: (download)
>d2vqtb3 b.1.4.0 (B:679-783) automated matches {Bacteroides thetaiotaomicron [TaxId: 818]}
vlinpiqqndslsvylisdrldtmeqmtlemkvvdfdgktlgkkiqvhslevpantskcv
yrakldgwltpedcrrsflklilkdksghqvaesvhffrktkdlq
Timeline for d2vqtb3: