Lineage for d2vqta4 (2vqt A:28-219)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 792799Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll
  4. 792800Superfamily b.18.1: Galactose-binding domain-like [49785] (32 families) (S)
  5. 792873Family b.18.1.5: beta-Galactosidase/glucuronidase, N-terminal domain [49803] (4 proteins)
  6. 793019Protein Beta-mannosidase [158959] (1 species)
  7. 793020Species Bacteroides thetaiotaomicron [TaxId:818] [158960] (9 PDB entries)
    Uniprot Q8AAK6 28-219
  8. 793035Domain d2vqta4: 2vqt A:28-219 [153472]
    Other proteins in same PDB: d2vqta1, d2vqta2, d2vqta3, d2vqta5, d2vqtb1, d2vqtb2, d2vqtb3, d2vqtb5
    automatically matched to 2JE8 A:28-219
    complexed with 15a, br, cl, edo

Details for d2vqta4

PDB Entry: 2vqt (more details), 2.1 Å

PDB Description: structural and biochemical evidence for a boat-like transition state in beta-mannosidases
PDB Compounds: (A:) beta-mannosidase

SCOP Domain Sequences for d2vqta4:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vqta4 b.18.1.5 (A:28-219) Beta-mannosidase {Bacteroides thetaiotaomicron [TaxId: 818]}
ndtsevmlldtgwefsqsgtekwmpatvpgtvhqdlishellpnpfygmnekkiqwvene
dweyrtsfivseeqlnrdgiqlifegldtyadvylngslllkadnmfvgytlpvksvlrk
genhlyiyfhspirqtlpqyasngfnypadndhhekhlsvfsrkapysygwdwgirmvts
gvwrpvtlrfyd

SCOP Domain Coordinates for d2vqta4:

Click to download the PDB-style file with coordinates for d2vqta4.
(The format of our PDB-style files is described here.)

Timeline for d2vqta4: