![]() | Class b: All beta proteins [48724] (178 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.4: beta-Galactosidase/glucuronidase domain [49303] (2 families) ![]() |
![]() | Family b.1.4.0: automated matches [254272] (1 protein) not a true family |
![]() | Protein automated matches [254633] (16 species) not a true protein |
![]() | Species Bacteroides thetaiotaomicron [TaxId:818] [255621] (1 PDB entry) |
![]() | Domain d2vqta2: 2vqt A:784-864 [153470] Other proteins in same PDB: d2vqta4, d2vqta5, d2vqtb4, d2vqtb5, d2vqtb6 automated match to d2je8a2 complexed with 15a, br, cl, edo |
PDB Entry: 2vqt (more details), 2.1 Å
SCOPe Domain Sequences for d2vqta2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2vqta2 b.1.4.0 (A:784-864) automated matches {Bacteroides thetaiotaomicron [TaxId: 818]} lpptsvsyqmkqtdgkceltlfssmlakdifietplqgarysdnffdllpgerkkviits prikkgeelpvnikhiretyk
Timeline for d2vqta2: