Lineage for d2vqft1 (2vqf T:8-106)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1985818Fold a.7: Spectrin repeat-like [46965] (16 superfamilies)
    3 helices; bundle, closed, left-handed twist; up-and-down
  4. 1985989Superfamily a.7.6: Ribosomal protein S20 [46992] (1 family) (S)
    automatically mapped to Pfam PF01649
  5. 1985990Family a.7.6.1: Ribosomal protein S20 [46993] (1 protein)
    this is a repeat family; one repeat unit is 2gyb T:4-86 found in domain
  6. 1985991Protein Ribosomal protein S20 [46994] (2 species)
  7. 1986019Species Thermus thermophilus [TaxId:274] [46995] (45 PDB entries)
    Uniprot P80380
  8. 1986022Domain d2vqft1: 2vqf T:8-106 [153463]
    Other proteins in same PDB: d2vqfb1, d2vqfd1, d2vqfe1, d2vqff1, d2vqfg1, d2vqfh1, d2vqfi1, d2vqfj1, d2vqfk1, d2vqfl1, d2vqfm1, d2vqfn1, d2vqfo1, d2vqfp1, d2vqfq1, d2vqfr1, d2vqfs1, d2vqfu1
    automatically matched to d1fjgt_
    complexed with k, mg, par, zn

Details for d2vqft1

PDB Entry: 2vqf (more details), 2.9 Å

PDB Description: modified uridines with c5-methylene substituents at the first position of the trna anticodon stabilize u-g wobble pairing during decoding
PDB Compounds: (T:) 30S ribosomal protein S20

SCOPe Domain Sequences for d2vqft1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vqft1 a.7.6.1 (T:8-106) Ribosomal protein S20 {Thermus thermophilus [TaxId: 274]}
rnlsalkrhrqslkrrlrnkakksaiktlskkavqlaqegkaeealkimrkaeslidkaa
kgstlhknaaarrksrlmrkvrqlleaagapliggglsa

SCOPe Domain Coordinates for d2vqft1:

Click to download the PDB-style file with coordinates for d2vqft1.
(The format of our PDB-style files is described here.)

Timeline for d2vqft1: