Lineage for d2vqfr1 (2vqf R:16-88)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1720410Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 1723549Superfamily a.4.8: Ribosomal protein S18 [46911] (1 family) (S)
  5. 1723550Family a.4.8.1: Ribosomal protein S18 [46912] (1 protein)
  6. 1723551Protein Ribosomal protein S18 [46913] (2 species)
  7. 1723577Species Thermus thermophilus [TaxId:274] [46914] (47 PDB entries)
    Uniprot P80382
  8. 1723580Domain d2vqfr1: 2vqf R:16-88 [153461]
    Other proteins in same PDB: d2vqfb1, d2vqfd1, d2vqfe1, d2vqff1, d2vqfg1, d2vqfh1, d2vqfi1, d2vqfj1, d2vqfk1, d2vqfl1, d2vqfm1, d2vqfn1, d2vqfo1, d2vqfp1, d2vqfq1, d2vqfs1, d2vqft1, d2vqfu1
    automatically matched to d1i94r_
    complexed with k, mg, par, zn

Details for d2vqfr1

PDB Entry: 2vqf (more details), 2.9 Å

PDB Description: modified uridines with c5-methylene substituents at the first position of the trna anticodon stabilize u-g wobble pairing during decoding
PDB Compounds: (R:) 30S ribosomal protein S18

SCOPe Domain Sequences for d2vqfr1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vqfr1 a.4.8.1 (R:16-88) Ribosomal protein S18 {Thermus thermophilus [TaxId: 274]}
psrkakvkatlgefdlrdyrnvevlkrflsetgkilprrrtglsgkeqrilaktikrari
lgllpfteklvrk

SCOPe Domain Coordinates for d2vqfr1:

Click to download the PDB-style file with coordinates for d2vqfr1.
(The format of our PDB-style files is described here.)

Timeline for d2vqfr1: