Lineage for d2vqfn1 (2vqf N:2-61)

  1. Root: SCOPe 2.07
  2. 2581248Class g: Small proteins [56992] (98 folds)
  3. 2586757Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily)
    alpha+beta metal(zinc)-bound fold
  4. 2586758Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (19 families) (S)
  5. 2587071Family g.39.1.7: Ribosomal protein S14 [57752] (1 protein)
  6. 2587072Protein Ribosomal protein S14 [57753] (2 species)
  7. 2587098Species Thermus thermophilus [TaxId:274] [57754] (45 PDB entries)
    Uniprot P24320
  8. 2587112Domain d2vqfn1: 2vqf N:2-61 [153457]
    Other proteins in same PDB: d2vqfb1, d2vqfd1, d2vqfe1, d2vqff1, d2vqfg1, d2vqfh1, d2vqfi1, d2vqfj1, d2vqfk1, d2vqfl1, d2vqfm1, d2vqfo1, d2vqfp1, d2vqfq1, d2vqfr1, d2vqfs1, d2vqft1, d2vqfu1
    automatically matched to d1fjgn_
    complexed with k, mg, par, zn

Details for d2vqfn1

PDB Entry: 2vqf (more details), 2.9 Å

PDB Description: modified uridines with c5-methylene substituents at the first position of the trna anticodon stabilize u-g wobble pairing during decoding
PDB Compounds: (N:) 30s ribosomal protein s14 type z

SCOPe Domain Sequences for d2vqfn1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vqfn1 g.39.1.7 (N:2-61) Ribosomal protein S14 {Thermus thermophilus [TaxId: 274]}
arkaliekakrtpkfkvraytrcvrcgrarsvyrffglcriclrelahkgqlpgvrkasw

SCOPe Domain Coordinates for d2vqfn1:

Click to download the PDB-style file with coordinates for d2vqfn1.
(The format of our PDB-style files is described here.)

Timeline for d2vqfn1: