| Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
| Fold d.140: Ribosomal protein S8 [56046] (1 superfamily) consists of 2 different alpha+beta subdomains arranged in a 4-layer structure: b/a/b/a |
Superfamily d.140.1: Ribosomal protein S8 [56047] (1 family) ![]() |
| Family d.140.1.1: Ribosomal protein S8 [56048] (1 protein) |
| Protein Ribosomal protein S8 [56049] (4 species) |
| Species Thermus thermophilus [TaxId:274] [56051] (46 PDB entries) Uniprot P24319 |
| Domain d2vqfh1: 2vqf H:1-138 [153451] Other proteins in same PDB: d2vqfb1, d2vqfd1, d2vqfe1, d2vqff1, d2vqfg1, d2vqfi1, d2vqfj1, d2vqfk1, d2vqfl1, d2vqfm1, d2vqfn1, d2vqfo1, d2vqfp1, d2vqfq1, d2vqfr1, d2vqfs1, d2vqft1, d2vqfu1 automatically matched to d1fjgh_ complexed with k, mg, par, zn |
PDB Entry: 2vqf (more details), 2.9 Å
SCOPe Domain Sequences for d2vqfh1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2vqfh1 d.140.1.1 (H:1-138) Ribosomal protein S8 {Thermus thermophilus [TaxId: 274]}
mltdpiadmltrirnatrvykestdvpasrfkeeilrilaregfikgyervdvdgkpylr
vylkygprrqgpdprpeqvihhirriskpgrrvyvgvkeiprvrrglgiailstskgvlt
drearklgvggelicevw
Timeline for d2vqfh1: