| Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
| Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.14: Ribosomal protein S6 [54995] (1 family) ![]() |
| Family d.58.14.1: Ribosomal protein S6 [54996] (1 protein) |
| Protein Ribosomal protein S6 [54997] (4 species) |
| Species Thermus thermophilus [TaxId:274] [54998] (53 PDB entries) Uniprot P23370 |
| Domain d2vqff1: 2vqf F:1-101 [153449] Other proteins in same PDB: d2vqfb1, d2vqfd1, d2vqfe1, d2vqfg1, d2vqfh1, d2vqfi1, d2vqfj1, d2vqfk1, d2vqfl1, d2vqfm1, d2vqfn1, d2vqfo1, d2vqfp1, d2vqfq1, d2vqfr1, d2vqfs1, d2vqft1, d2vqfu1 automatically matched to d1fjgf_ complexed with k, mg, par, zn |
PDB Entry: 2vqf (more details), 2.9 Å
SCOPe Domain Sequences for d2vqff1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2vqff1 d.58.14.1 (F:1-101) Ribosomal protein S6 {Thermus thermophilus [TaxId: 274]}
mrryevnivlnpnldqsqlalekeiiqralenygarvekveelglrrlaypiakdpqgyf
lwyqvempedrvndlarelrirdnvrrvmvvksqepflana
Timeline for d2vqff1: