Lineage for d2vqfe1 (2vqf E:5-154)

  1. Root: SCOPe 2.08
  2. 3042554Class i: Low resolution protein structures [58117] (25 folds)
  3. 3042555Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)
  4. 3042556Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) (S)
  5. 3044140Family i.1.1.3: Small subunit [58132] (3 proteins)
  6. 3044218Protein Prokaryotic (30S subunit) [58133] (1 species)
  7. 3044219Species Thermus thermophilus [TaxId:274] [58134] (13 PDB entries)
  8. 3044221Domain d2vqfe1: 2vqf E:5-154 [153448]
    Other proteins in same PDB: d2vqfb1, d2vqfd1, d2vqff1, d2vqfg1, d2vqfh1, d2vqfi1, d2vqfj1, d2vqfk1, d2vqfl1, d2vqfm1, d2vqfn1, d2vqfo1, d2vqfp1, d2vqfq1, d2vqfr1, d2vqfs1, d2vqft1, d2vqfu1
    automatically matched to d1fkae_
    complexed with k, mg, par, zn

Details for d2vqfe1

PDB Entry: 2vqf (more details), 2.9 Å

PDB Description: modified uridines with c5-methylene substituents at the first position of the trna anticodon stabilize u-g wobble pairing during decoding
PDB Compounds: (E:) 30S ribosomal protein S5

SCOPe Domain Sequences for d2vqfe1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vqfe1 i.1.1.3 (E:5-154) Prokaryotic (30S subunit) {Thermus thermophilus [TaxId: 274]}
dfeekmilirrtarmqaggrrfrfgalvvvgdrqgrvglgfgkapevplavqkagyyarr
nmvevplqngtipheievefgaskivlkpaapgtgviagavprailelagvtdiltkelg
srnpiniayatmealrqlrtkadverlrkg

SCOPe Domain Coordinates for d2vqfe1:

Click to download the PDB-style file with coordinates for d2vqfe1.
(The format of our PDB-style files is described here.)

Timeline for d2vqfe1: