Lineage for d2vqfd1 (2vqf D:2-209)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2956861Fold d.66: Alpha-L RNA-binding motif [55173] (1 superfamily)
    alpha(2)-beta(2)-loop-beta; 2 layers: alpha/beta
  4. 2956862Superfamily d.66.1: Alpha-L RNA-binding motif [55174] (5 families) (S)
    common motif in otherwise different folds
  5. 2956863Family d.66.1.2: Ribosomal protein S4 (bacteria) [55178] (1 protein)
    has a RRF/tRNA synthetase additional domain-like fold
  6. 2956864Protein Ribosomal protein S4 [55179] (3 species)
    also contains a Zn-binding N-terminal subdomain
  7. 2956895Species Thermus thermophilus [TaxId:274] [55180] (45 PDB entries)
  8. 2956907Domain d2vqfd1: 2vqf D:2-209 [153447]
    Other proteins in same PDB: d2vqfb1, d2vqfe1, d2vqff1, d2vqfg1, d2vqfh1, d2vqfi1, d2vqfj1, d2vqfk1, d2vqfl1, d2vqfm1, d2vqfn1, d2vqfo1, d2vqfp1, d2vqfq1, d2vqfr1, d2vqfs1, d2vqft1, d2vqfu1
    automatically matched to d1hnwd_
    complexed with k, mg, par, zn

Details for d2vqfd1

PDB Entry: 2vqf (more details), 2.9 Å

PDB Description: modified uridines with c5-methylene substituents at the first position of the trna anticodon stabilize u-g wobble pairing during decoding
PDB Compounds: (D:) 30S ribosomal protein S4

SCOPe Domain Sequences for d2vqfd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vqfd1 d.66.1.2 (D:2-209) Ribosomal protein S4 {Thermus thermophilus [TaxId: 274]}
gryigpvcrlcrregvklylkgercyspkcamerrpyppgqhgqkrarrpsdyavrlrek
qklrriygiserqfrnlfeeaskkkgvtgsvflgllesrldnvvyrlgfavsrrqarqlv
rhghitvngrrvdlpsyrvrpgdeiavaeksrnlelirqnleamkgrkvgpwlsldvegm
kgkflrlpdredlalpvneqlviefysr

SCOPe Domain Coordinates for d2vqfd1:

Click to download the PDB-style file with coordinates for d2vqfd1.
(The format of our PDB-style files is described here.)

Timeline for d2vqfd1: