![]() | Class i: Low resolution protein structures [58117] (25 folds) |
![]() | Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily) |
![]() | Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) ![]() |
![]() | Family i.1.1.1: Ribosome complexes [58120] (1 protein) |
![]() | Protein 70S ribosome functional complex [58121] (9 species) |
![]() | Species Thermus thermophilus [TaxId:274] [58122] (21 PDB entries) |
![]() | Domain d2vqes1: 2vqe S:2-81 [153443] Other proteins in same PDB: d2vqeb1, d2vqed1, d2vqee1, d2vqef1, d2vqeg1, d2vqeh1, d2vqei1, d2vqej1, d2vqek1, d2vqem1, d2vqen1, d2vqeq1, d2vqer1, d2vqet1, d2vqeu1 automatically matched to d1ibms_ complexed with k, mg, par, zn |
PDB Entry: 2vqe (more details), 2.5 Å
SCOPe Domain Sequences for d2vqes1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2vqes1 i.1.1.1 (S:2-81) 70S ribosome functional complex {Thermus thermophilus [TaxId: 274]} prslkkgvfvddhllekvlelnakgekrliktwsrrstivpemvghtiavyngkqhvpvy itenmvghklgefaptrtyr
Timeline for d2vqes1: