Lineage for d2vqer1 (2vqe R:16-88)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2691777Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2695537Superfamily a.4.8: Ribosomal protein S18 [46911] (1 family) (S)
  5. 2695538Family a.4.8.1: Ribosomal protein S18 [46912] (1 protein)
  6. 2695539Protein Ribosomal protein S18 [46913] (2 species)
  7. 2695565Species Thermus thermophilus [TaxId:274] [46914] (47 PDB entries)
    Uniprot P80382
  8. 2695568Domain d2vqer1: 2vqe R:16-88 [153442]
    Other proteins in same PDB: d2vqeb1, d2vqed1, d2vqee1, d2vqef1, d2vqeg1, d2vqeh1, d2vqei1, d2vqej1, d2vqek1, d2vqel1, d2vqem1, d2vqen1, d2vqeo1, d2vqep1, d2vqeq1, d2vqes1, d2vqet1, d2vqeu1
    automatically matched to d1i94r_
    complexed with k, mg, par, zn

Details for d2vqer1

PDB Entry: 2vqe (more details), 2.5 Å

PDB Description: modified uridines with c5-methylene substituents at the first position of the trna anticodon stabilize u-g wobble pairing during decoding
PDB Compounds: (R:) 30S ribosomal protein S18

SCOPe Domain Sequences for d2vqer1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vqer1 a.4.8.1 (R:16-88) Ribosomal protein S18 {Thermus thermophilus [TaxId: 274]}
psrkakvkatlgefdlrdyrnvevlkrflsetgkilprrrtglsgkeqrilaktikrari
lgllpfteklvrk

SCOPe Domain Coordinates for d2vqer1:

Click to download the PDB-style file with coordinates for d2vqer1.
(The format of our PDB-style files is described here.)

Timeline for d2vqer1: