Lineage for d2vqeo1 (2vqe O:2-89)

  1. Root: SCOPe 2.02
  2. 1248417Class i: Low resolution protein structures [58117] (25 folds)
  3. 1248418Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)
  4. 1248419Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) (S)
  5. 1248420Family i.1.1.1: Ribosome complexes [58120] (1 protein)
  6. 1248421Protein 70S ribosome functional complex [58121] (9 species)
  7. 1249067Species Thermus thermophilus [TaxId:274] [58122] (21 PDB entries)
  8. 1249069Domain d2vqeo1: 2vqe O:2-89 [153439]
    Other proteins in same PDB: d2vqeb1, d2vqed1, d2vqee1, d2vqef1, d2vqeg1, d2vqeh1, d2vqei1, d2vqej1, d2vqek1, d2vqem1, d2vqen1, d2vqeq1, d2vqer1, d2vqet1, d2vqeu1
    automatically matched to d1eg0f_
    complexed with k, mg, par, zn

Details for d2vqeo1

PDB Entry: 2vqe (more details), 2.5 Å

PDB Description: modified uridines with c5-methylene substituents at the first position of the trna anticodon stabilize u-g wobble pairing during decoding
PDB Compounds: (O:) 30S ribosomal protein S15

SCOPe Domain Sequences for d2vqeo1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vqeo1 i.1.1.1 (O:2-89) 70S ribosome functional complex {Thermus thermophilus [TaxId: 274]}
pitkeekqkviqefarfpgdtgstevqvalltlrinrlsehlkvhkkdhhshrgllmmvg
qrrrllrylqredperyralieklgirg

SCOPe Domain Coordinates for d2vqeo1:

Click to download the PDB-style file with coordinates for d2vqeo1.
(The format of our PDB-style files is described here.)

Timeline for d2vqeo1: