Class a: All alpha proteins [46456] (284 folds) |
Fold a.156: S13-like H2TH domain [81297] (1 superfamily) core: 3-4 helices |
Superfamily a.156.1: S13-like H2TH domain [46946] (3 families) contains a helix-two turns-helix (H2TH) motif |
Family a.156.1.1: Ribosomal protein S13 [46947] (1 protein) contains 3 helices and a beta-hairpin in the core and a non-globular C-terminal extension |
Protein Ribosomal protein S13 [46948] (2 species) |
Species Thermus thermophilus [TaxId:274] [46949] (44 PDB entries) Uniprot P80377 |
Domain d2vqem1: 2vqe M:2-126 [153437] Other proteins in same PDB: d2vqeb1, d2vqed1, d2vqee1, d2vqef1, d2vqeg1, d2vqeh1, d2vqei1, d2vqej1, d2vqek1, d2vqel1, d2vqen1, d2vqeo1, d2vqep1, d2vqeq1, d2vqer1, d2vqes1, d2vqet1, d2vqeu1 automatically matched to d1fjgm_ complexed with k, mg, par, tm2, zn |
PDB Entry: 2vqe (more details), 2.5 Å
SCOP Domain Sequences for d2vqem1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2vqem1 a.156.1.1 (M:2-126) Ribosomal protein S13 {Thermus thermophilus [TaxId: 274]} ariagveiprnkrvdvaltyiygigkarakealektginpatrvkdlteaevvrlreyve ntwklegelraevaanikrlmdigcyrglrhrrglpvrgqrtrtnartrkgprktvagkk kaprk
Timeline for d2vqem1: