![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
![]() | Superfamily c.55.4: Translational machinery components [53137] (3 families) ![]() |
![]() | Family c.55.4.1: Ribosomal protein L18 and S11 [53138] (2 proteins) |
![]() | Protein Ribosomal protein S11 [53141] (2 species) |
![]() | Species Thermus thermophilus [TaxId:274] [53142] (46 PDB entries) Uniprot P80376 |
![]() | Domain d2vqek1: 2vqe K:11-126 [153435] Other proteins in same PDB: d2vqeb1, d2vqed1, d2vqee1, d2vqef1, d2vqeg1, d2vqeh1, d2vqei1, d2vqej1, d2vqel1, d2vqem1, d2vqen1, d2vqeo1, d2vqep1, d2vqeq1, d2vqer1, d2vqes1, d2vqet1, d2vqeu1 automatically matched to d1i94k_ complexed with k, mg, par, zn |
PDB Entry: 2vqe (more details), 2.5 Å
SCOPe Domain Sequences for d2vqek1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2vqek1 c.55.4.1 (K:11-126) Ribosomal protein S11 {Thermus thermophilus [TaxId: 274]} krqvasgrayihasynntivtitdpdgnpitwssggvigykgsrkgtpyaaqlaaldaak kamaygmqsvdvivrgtgagreqairalqasglqvksivddtpvphngcrpkkkfr
Timeline for d2vqek1: