Lineage for d2vqeh1 (2vqe H:1-138)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1219328Fold d.140: Ribosomal protein S8 [56046] (1 superfamily)
    consists of 2 different alpha+beta subdomains arranged in a 4-layer structure: b/a/b/a
  4. 1219329Superfamily d.140.1: Ribosomal protein S8 [56047] (1 family) (S)
  5. 1219330Family d.140.1.1: Ribosomal protein S8 [56048] (1 protein)
  6. 1219331Protein Ribosomal protein S8 [56049] (4 species)
  7. 1219349Species Thermus thermophilus [TaxId:274] [56051] (46 PDB entries)
    Uniprot P24319
  8. 1219353Domain d2vqeh1: 2vqe H:1-138 [153432]
    Other proteins in same PDB: d2vqeb1, d2vqed1, d2vqee1, d2vqef1, d2vqeg1, d2vqei1, d2vqej1, d2vqek1, d2vqel1, d2vqem1, d2vqen1, d2vqeo1, d2vqep1, d2vqeq1, d2vqer1, d2vqes1, d2vqet1, d2vqeu1
    automatically matched to d1fjgh_
    complexed with k, mg, par, zn

Details for d2vqeh1

PDB Entry: 2vqe (more details), 2.5 Å

PDB Description: modified uridines with c5-methylene substituents at the first position of the trna anticodon stabilize u-g wobble pairing during decoding
PDB Compounds: (H:) 30S ribosomal protein S8

SCOPe Domain Sequences for d2vqeh1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vqeh1 d.140.1.1 (H:1-138) Ribosomal protein S8 {Thermus thermophilus [TaxId: 274]}
mltdpiadmltrirnatrvykestdvpasrfkeeilrilaregfikgyervdvdgkpylr
vylkygprrqgpdprpeqvihhirriskpgrrvyvgvkeiprvrrglgiailstskgvlt
drearklgvggelicevw

SCOPe Domain Coordinates for d2vqeh1:

Click to download the PDB-style file with coordinates for d2vqeh1.
(The format of our PDB-style files is described here.)

Timeline for d2vqeh1: