Lineage for d2vqed1 (2vqe D:2-209)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1655967Fold d.66: Alpha-L RNA-binding motif [55173] (1 superfamily)
    alpha(2)-beta(2)-loop-beta; 2 layers: alpha/beta
  4. 1655968Superfamily d.66.1: Alpha-L RNA-binding motif [55174] (5 families) (S)
    common motif in otherwise different folds
  5. 1655969Family d.66.1.2: Ribosomal protein S4 (bacteria) [55178] (1 protein)
    has a RRF/tRNA synthetase additional domain-like fold
  6. 1655970Protein Ribosomal protein S4 [55179] (3 species)
    also contains a Zn-binding N-terminal subdomain
  7. 1656001Species Thermus thermophilus [TaxId:274] [55180] (45 PDB entries)
  8. 1656003Domain d2vqed1: 2vqe D:2-209 [153428]
    Other proteins in same PDB: d2vqeb1, d2vqee1, d2vqef1, d2vqeg1, d2vqeh1, d2vqei1, d2vqej1, d2vqek1, d2vqel1, d2vqem1, d2vqen1, d2vqeo1, d2vqep1, d2vqeq1, d2vqer1, d2vqes1, d2vqet1, d2vqeu1
    automatically matched to d1hnwd_
    complexed with k, mg, par, zn

Details for d2vqed1

PDB Entry: 2vqe (more details), 2.5 Å

PDB Description: modified uridines with c5-methylene substituents at the first position of the trna anticodon stabilize u-g wobble pairing during decoding
PDB Compounds: (D:) 30S ribosomal protein S4

SCOPe Domain Sequences for d2vqed1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vqed1 d.66.1.2 (D:2-209) Ribosomal protein S4 {Thermus thermophilus [TaxId: 274]}
gryigpvcrlcrregvklylkgercyspkcamerrpyppgqhgqkrarrpsdyavrlrek
qklrriygiserqfrnlfeeaskkkgvtgsvflgllesrldnvvyrlgfavsrrqarqlv
rhghitvngrrvdlpsyrvrpgdeiavaeksrnlelirqnleamkgrkvgpwlsldvegm
kgkflrlpdredlalpvneqlviefysr

SCOPe Domain Coordinates for d2vqed1:

Click to download the PDB-style file with coordinates for d2vqed1.
(The format of our PDB-style files is described here.)

Timeline for d2vqed1: