Lineage for d2vqca1 (2vqc A:4-73)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 761139Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 761866Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (84 families) (S)
    contains a small beta-sheet (wing)
  5. 763048Family a.4.5.78: F112-like [158320] (1 protein)
  6. 763049Protein F-112 [158321] (1 species)
  7. 763050Species Sulfolobus virus-like particle SSV1 [TaxId:244589] [158322] (1 PDB entry)
    Uniprot P20220 4-73
  8. 763051Domain d2vqca1: 2vqc A:4-73 [153426]

Details for d2vqca1

PDB Entry: 2vqc (more details), 2.3 Å

PDB Description: structure of a dna binding winged-helix protein, f-112, from sulfolobus spindle-shaped virus 1.
PDB Compounds: (A:) hypothetical 13.2 kda protein

SCOP Domain Sequences for d2vqca1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vqca1 a.4.5.78 (A:4-73) F-112 {Sulfolobus virus-like particle SSV1 [TaxId: 244589]}
tlnsykmaeimykilekkgeltledilaqfeisvpsayniqralkaicerhpdecevqyk
nrkttfkwik

SCOP Domain Coordinates for d2vqca1:

Click to download the PDB-style file with coordinates for d2vqca1.
(The format of our PDB-style files is described here.)

Timeline for d2vqca1: