SCOPe 2.05: Domain d2vq0b1: 2vq0 B:73-268

Lineage for d2vq0b1 (2vq0 B:73-268)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies)
   sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands
   characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies

4. Superfamily b.121.4: Positive stranded ssRNA viruses [88633] (10 families)

5. Family b.121.4.7: Tombusviridae-like VP [88643] (5 proteins)

6. Protein Sobemovirus coat protein [88644] (4 species)

7. Species SMV (Sesbania mosaic virus) [TaxId:12558] [49624] (5 PDB entries)
   Uniprot Q9EB06

8. Domain d2vq0b1: 2vq0 B:73-268 [153423]
   automatically matched to d1vaka_
   complexed with ca; mutant

Details for d2vq0b1

PDB Entry: 2vq0, 3.6 Å

PDB Description: capsid structure of sesbania mosaic virus coat protein deletion mutant rcp(delta 48 to 59)

PDB Compounds: (B:) coat protein

SCOPe Domain Sequences for d2vq0b1:

Sequence; same for both SEQRES and ATOM records:

>d2vq0b1 b.121.4.7 (B:73-268) Sobemovirus coat protein {SMV (Sesbania mosaic virus) [TaxId: 12558]}
gitvlthselsaeigvtdsivvsselvmpytvgtwlrgvaanwskyswlsvrytyipscp
sstagsihmgfqydmadtvpvsvnqlsnlrgyvsgqvwsgsaglcfingtrcsdtstais
ttldvsklgkkwypyktsadyatavgvdvniatplvparlvialldgssstavaagriyc
tytiqmieptasalnn

Timeline for d2vq0b1:

• d2vq0b1 first appeared in SCOP 1.75
  
• d2vq0b1 appears in SCOPe 2.04
  
• d2vq0b1 appears in SCOPe 2.06
  
• d2vq0b1 appears in the current release, SCOPe 2.08