SCOPe 2.07: Domain d2vp6h_: 2vp6 H:

Lineage for d2vp6h_ (2vp6 H:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.1: Nucleotide and nucleoside kinases [52541] (21 proteins)
   parallel beta-sheet of 5 strands, order 23145

6. Protein automated matches [190087] (15 species)
   not a true protein

7. Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [233748] (6 PDB entries)

8. Domain d2vp6h_: 2vp6 H: [153412]
   automated match to d2vp4d_
   protein/DNA complex; complexed with 5fu, so4

Details for d2vp6h_

PDB Entry: 2vp6, 3 Å

PDB Description: structural studies of nucleoside analog and feedback inhibitor binding to drosophila melanogaster multisubstrate deoxyribonucleoside kinase

PDB Compounds: (H:) deoxynucleoside kinase

SCOPe Domain Sequences for d2vp6h_:

Sequence, based on SEQRES records:

>d2vp6h_ c.37.1.1 (H:) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
tkyaegtqpftvliegnigsgkttylnhfekykndiclltepvekwrnvngvnllelmyk
dpkkwampfqsyvtltmlqshtaptnkklkimersifsarycfvenmrrngsleqgmynt
leewykfieesihvqadliiylrtspevayerirqrarseescvplkylqelhelhedwl
ihqrrpqsckvlvldad

Sequence, based on observed residues (ATOM records):

>d2vp6h_ c.37.1.1 (H:) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
tkyaegtqpftvliegnigsgkttylnhfekykndiclltepvekwrnvngvnllelmyk
dpkkwampfqsyvtltmlqshtaptnkklkimersifsarycfvenmrrngsleqgmynt
leewykfieesihvqadliiylrtspevayerirqrarseescvplkylqelhelhedwl
ihqckvlvldad

Timeline for d2vp6h_:

• d2vp6h_ first appeared in SCOP 1.75, called d2vp6h1
  
• d2vp6h_ appears in SCOPe 2.06
  
• d2vp6h_ appears in the current release, SCOPe 2.08