SCOP 1.75: Domain d2vp6h1: 2vp6 H:12-208

Lineage for d2vp6h1 (2vp6 H:12-208)

1. Root: SCOP 1.75

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (24 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.1: Nucleotide and nucleoside kinases [52541] (20 proteins)
   parallel beta-sheet of 5 strands, order 23145

6. Protein Deoxyribonucleoside kinase [69478] (1 species)

7. Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [69479] (11 PDB entries)

8. Domain d2vp6h1: 2vp6 H:12-208 [153412]
   automatically matched to d1oe0a_
   complexed with 5fu, so4

Details for d2vp6h1

PDB Entry: 2vp6, 3 Å

PDB Description: structural studies of nucleoside analog and feedback inhibitor binding to drosophila melanogaster multisubstrate deoxyribonucleoside kinase

PDB Compounds: (H:) deoxynucleoside kinase

SCOP Domain Sequences for d2vp6h1:

Sequence, based on SEQRES records:

>d2vp6h1 c.37.1.1 (H:12-208) Deoxyribonucleoside kinase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
tkyaegtqpftvliegnigsgkttylnhfekykndiclltepvekwrnvngvnllelmyk
dpkkwampfqsyvtltmlqshtaptnkklkimersifsarycfvenmrrngsleqgmynt
leewykfieesihvqadliiylrtspevayerirqrarseescvplkylqelhelhedwl
ihqrrpqsckvlvldad

Sequence, based on observed residues (ATOM records):

>d2vp6h1 c.37.1.1 (H:12-208) Deoxyribonucleoside kinase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
tkyaegtqpftvliegnigsgkttylnhfekykndiclltepvekwrnvngvnllelmyk
dpkkwampfqsyvtltmlqshtaptnkklkimersifsarycfvenmrrngsleqgmynt
leewykfieesihvqadliiylrtspevayerirqrarseescvplkylqelhelhedwl
ihqckvlvldad

Timeline for d2vp6h1:

• d2vp6h1 is new in SCOP 1.75
  
• d2vp6h1 appears in SCOPe 2.01
  
• d2vp6h1 appears in the current release, SCOPe 2.08, called d2vp6h_