![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
![]() | Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) ![]() division into families based on beta-sheet topologies |
![]() | Family c.37.1.1: Nucleotide and nucleoside kinases [52541] (21 proteins) parallel beta-sheet of 5 strands, order 23145 |
![]() | Protein automated matches [190087] (10 species) not a true protein |
![]() | Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [233748] (5 PDB entries) |
![]() | Domain d2vp6d_: 2vp6 D: [153408] automated match to d2vp4d_ protein/DNA complex; complexed with 5fu, so4 |
PDB Entry: 2vp6 (more details), 3 Å
SCOPe Domain Sequences for d2vp6d_:
Sequence, based on SEQRES records: (download)
>d2vp6d_ c.37.1.1 (D:) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} tkyaegtqpftvliegnigsgkttylnhfekykndiclltepvekwrnvngvnllelmyk dpkkwampfqsyvtltmlqshtaptnkklkimersifsarycfvenmrrngsleqgmynt leewykfieesihvqadliiylrtspevayerirqrarseescvplkylqelhelhedwl ihqrrpqsckvlvldad
>d2vp6d_ c.37.1.1 (D:) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} tkyaegtqpftvliegnigsgkttylnhfekykndiclltepvekwrnvngvnllelmyk dpkkwampfqsyvtltmlqshtaptnkklkimersifsarycfvenmrrngsleqgmynt leewykfieesihvqadliiylrtspevayerirqrarseescvplkylqelhelhedwl ihckvlvldad
Timeline for d2vp6d_: