Lineage for d2vp6b_ (2vp6 B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2865683Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2865684Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. 2865685Family c.37.1.1: Nucleotide and nucleoside kinases [52541] (21 proteins)
    parallel beta-sheet of 5 strands, order 23145
  6. 2866233Protein automated matches [190087] (15 species)
    not a true protein
  7. 2866253Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [233748] (6 PDB entries)
  8. 2866268Domain d2vp6b_: 2vp6 B: [153406]
    automated match to d2vp4d_
    protein/DNA complex; complexed with 5fu, so4

Details for d2vp6b_

PDB Entry: 2vp6 (more details), 3 Å

PDB Description: structural studies of nucleoside analog and feedback inhibitor binding to drosophila melanogaster multisubstrate deoxyribonucleoside kinase
PDB Compounds: (B:) deoxynucleoside kinase

SCOPe Domain Sequences for d2vp6b_:

Sequence, based on SEQRES records: (download)

>d2vp6b_ c.37.1.1 (B:) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
tkyaegtqpftvliegnigsgkttylnhfekykndiclltepvekwrnvngvnllelmyk
dpkkwampfqsyvtltmlqshtaptnkklkimersifsarycfvenmrrngsleqgmynt
leewykfieesihvqadliiylrtspevayerirqrarseescvplkylqelhelhedwl
ihqrrpqsckvlvldad

Sequence, based on observed residues (ATOM records): (download)

>d2vp6b_ c.37.1.1 (B:) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
tkyaegtqpftvliegnigsgkttylnhfekykndiclltepvekwrnvngvnllelmyk
dpkkwampfqsyvtltmlqshtaptnkklkimersifsarycfvenmrrngsleqgmynt
leewykfieesihvqadliiylrtspevayerirqrarseescvplkylqelhelhedwl
ihqckvlvldad

SCOPe Domain Coordinates for d2vp6b_:

Click to download the PDB-style file with coordinates for d2vp6b_.
(The format of our PDB-style files is described here.)

Timeline for d2vp6b_: