| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) ![]() division into families based on beta-sheet topologies |
| Family c.37.1.1: Nucleotide and nucleoside kinases [52541] (21 proteins) parallel beta-sheet of 5 strands, order 23145 |
| Protein automated matches [190087] (15 species) not a true protein |
| Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [233748] (6 PDB entries) |
| Domain d2vp6a_: 2vp6 A: [153405] automated match to d2vp4d_ protein/DNA complex; complexed with 5fu, so4 |
PDB Entry: 2vp6 (more details), 3 Å
SCOPe Domain Sequences for d2vp6a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2vp6a_ c.37.1.1 (A:) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
tkyaegtqpftvliegnigsgkttylnhfekykndiclltepvekwrnvngvnllelmyk
dpkkwampfqsyvtltmlqshtaptnkklkimersifsarycfvenmrrngsleqgmynt
leewykfieesihvqadliiylrtspevayerirqrarseescvplkylqelhelhedwl
ihqrrpqsckvlvldad
Timeline for d2vp6a_: