SCOPe 2.08: Domain d2vp4b_: 2vp4 B:

Lineage for d2vp4b_ (2vp4 B:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.1: Nucleotide and nucleoside kinases [52541] (21 proteins)
   parallel beta-sheet of 5 strands, order 23145

6. Protein Deoxyribonucleoside kinase [69478] (1 species)

7. Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [69479] (11 PDB entries)

8. Domain d2vp4b_: 2vp4 B: [153400]
   automated match to d1oe0a_
   protein/DNA complex; complexed with dcp
   has additional insertions and/or extensions that are not grouped together

Details for d2vp4b_

PDB Entry: 2vp4, 2.2 Å

PDB Description: structural studies of nucleoside analog and feedback inhibitor binding to drosophila melanogaster multisubstrate deoxyribonucleoside kinase

PDB Compounds: (B:) deoxynucleoside kinase

SCOPe Domain Sequences for d2vp4b_:

Sequence; same for both SEQRES and ATOM records:

>d2vp4b_ c.37.1.1 (B:) Deoxyribonucleoside kinase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
tkyaegtqpftvliegnigsgkttylnhfekykndiclltepvekwrnvngvnllelmyk
dpkkwampfqsyvtltmlqshtaptnkklkimersifsarycfvenmrrngsleqgmynt
leewykfieesihvqadliiylrtspevayerirqrarseescvplkylqelhelhedwl
ihqrrpqsckvlvldadl

Timeline for d2vp4b_:

• d2vp4b_ first appeared in SCOP 1.75, called d2vp4b1
  
• d2vp4b_ appears in SCOPe 2.07