Lineage for d2vp2a_ (2vp2 A:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1845072Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 1845073Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) (S)
    division into families based on beta-sheet topologies
  5. 1845074Family c.37.1.1: Nucleotide and nucleoside kinases [52541] (21 proteins)
    parallel beta-sheet of 5 strands, order 23145
  6. 1845270Protein Deoxyribonucleoside kinase [69478] (1 species)
  7. 1845271Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [69479] (11 PDB entries)
  8. 1845286Domain d2vp2a_: 2vp2 A: [153397]
    automated match to d1oe0a_
    protein/DNA complex; complexed with dgt

Details for d2vp2a_

PDB Entry: 2vp2 (more details), 2.5 Å

PDB Description: structural studies of nucleoside analog and feedback inhibitor binding to drosophila melanogaster multisubstrate deoxyribonucleoside kinase
PDB Compounds: (A:) deoxynucleoside kinase

SCOPe Domain Sequences for d2vp2a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vp2a_ c.37.1.1 (A:) Deoxyribonucleoside kinase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
tkyaegtqpftvliegnigsgkttylnhfekykndiclltepvekwrnvngvnllelmyk
dpkkwampfqsyvtltmlqshtaptnkklkimersifsarycfvenmrrngsleqgmynt
leewykfieesihvqadliiylrtspevayerirqrarseescvplkylqelhelhedwl
ihqrrpqsckvlvldadl

SCOPe Domain Coordinates for d2vp2a_:

Click to download the PDB-style file with coordinates for d2vp2a_.
(The format of our PDB-style files is described here.)

Timeline for d2vp2a_: