Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.16: FAD-linked reductases, C-terminal domain [54372] (1 superfamily) alpha+beta sandwich |
Superfamily d.16.1: FAD-linked reductases, C-terminal domain [54373] (8 families) N-terminal domain is beta/beta/alpha common fold |
Family d.16.1.2: PHBH-like [54378] (4 proteins) |
Protein Dihydroxypyridine hydroxylase DhpH [159950] (1 species) |
Species Arthrobacter nicotinovorans [TaxId:29320] [159951] (1 PDB entry) Uniprot Q93NG3 164-201 |
Domain d2vouc2: 2vou C:164-291 [153394] Other proteins in same PDB: d2voua1, d2voub1, d2vouc1 automated match to d2voua2 complexed with act, fad, gol |
PDB Entry: 2vou (more details), 2.6 Å
SCOPe Domain Sequences for d2vouc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2vouc2 d.16.1.2 (C:164-291) Dihydroxypyridine hydroxylase DhpH {Arthrobacter nicotinovorans [TaxId: 29320]} ptyagyvtwrgvlqpgevaddvwnyfndkftygllddghliaypipgrenaesprlnfqw ywnvaegpdldelmtdvrgirlptsvhnnslnphnlrqfhskgeslfkpfrdlvlnassp fvtvvada
Timeline for d2vouc2:
View in 3D Domains from other chains: (mouse over for more information) d2voua1, d2voua2, d2voub1, d2voub2 |